PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604281.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 348aa    MW: 40107.5 Da    PI: 6.0462
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604281.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
   XP_009604281.1 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding53.36.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
   XP_009604281.1  67 RGRFTPEEEKLIISLHGAVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466895.08E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.7E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-251568IPR009057Homeodomain-like
CDDcd001674.01E-111761No hitNo description
PROSITE profilePS5129425.29662116IPR017930Myb domain
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2569117IPR009057Homeodomain-like
CDDcd001671.66E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGAVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKLKKPS  120
KQSTNNTTYI TDQQQQQQQR SQLAYNTITT SQPEIFLTQD LGLTKSQVLQ DSSLLINSPN  180
QLFFFDNGSL DTMTNVNDVT NRGTNNASLF QEISVLNSEF WQVDQQQHQH QVQSSYTTGM  240
DSNYLPPLIE TTVSPVEIPN SKYNNNMIVE GQDNNQMNEE WSSSPRITRT NREMVQLTEE  300
WSHVDTQQCC PSYLFWDQEI RSLDGDEILD PSTSNNLGQI LSAFPSSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX952971e-159X95297.1 L.esculentum mRNA for THM1 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604281.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLQ435241e-157Q43524_SOLLC; Transcription factor
STRINGSolyc08g081500.1.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-81myb domain protein 103